This work is licensed under a Creative Commons Attribution 4.0 International License.
ALT614
General Information
DRACP ID DRACP01140
Peptide Name ALT614
Sequence MADIKQEHDTELDQNYSLGSNTDPKNMQELTQYVQTLLQSVQDKFQTMSDQILNRIDEMGSRIDDLEKNISDLMTQAGVEGPDK
Sequence Length 84
UniProt ID Not available
PubChem CID Not available
Origin Antlion
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MKN28 | Gastric tubular adenocarcinoma | Carcinoma | IC50=52.51 μg/ml | MTT assay | 24 h | Patent |
| MGC-803 | Gastric mucinous adenocarcinoma | Carcinoma | IC50=58.33 μg/ml | MTT assay | 24 h | Patent |
| SGC-7901 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=45.06 μg/ml | MTT assay | 24 h | Patent |
| AGS | Gastric adenocarcinoma | Carcinoma | IC50=50.37 μg/ml | MTT assay | 24 h | Patent |
| MKN45 | Gastric adenocarcinoma | Carcinoma | IC50=40.65 μg/ml | MTT assay | 24 h | Patent |
| KATO III | Down syndrome; Gastric signet ring cell adenocarcinoma | Carcinoma | IC50=57.52 μg/ml | MTT assay | 24 h | Patent |
| BGC-823 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=49.45 μg/ml | MTT assay | 24 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C403H650N112O148S5
Absent amino acids CW
Common amino acids DQ
Mass 1107325
Pl 3.95
Basic residues 8
Acidic residues 17
Hydrophobic residues 19
Net charge -9
Boman Index -22554
Hydrophobicity -93.69
Aliphatic Index 73.1
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 2980
Absorbance 280nm 35.9
Polar residues 23
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN109485711A
Patent Title Antlion micromolecular peptide and separation and purification method and application thereof
Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: CN; Legal Status: Active; Application No: 201811252747; Filed: Oct 25, 2018; Published: Mar 19, 2019; Earliest Priority: Oct 25, 2018; Granted: Jul 20, 2021
Other Published ID CN109485711B
This work is licensed under a Creative Commons Attribution 4.0 International License.