B6

General Information


DRACP ID  DRACP01182

Peptide Name   B6

Sequence  GAVPCGETCVYLPCITAAIGCSCQNKVCYRD

Sequence Length  31

UniProt ID  Not available

PubChem CID  Not available

Origin  Hedyotis biflora

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
BxPC-3 Pancreatic ductal adenocarcinoma Carcinoma IC50=2.33 μM MTT assay 72h Patent
Capan-2 Pancreatic ductal adenocarcinoma Carcinoma IC50=1.85 μM MTT assay 72h Patent
MOH-1 Pancreatic adenocarcinoma Carcinoma IC50=2.10 μM MTT assay 72h Patent
PANC-1 Pancreatic ductal adenocarcinoma Carcinoma IC50=1.97 μM MTT assay 72h Patent

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer



Structure Information


PDB ID  Not available

Predicted Structure  DRACP01182

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C135H217N37O43S6

Absent amino acids  FHMW

Common amino acids  C

Mass  377411

Pl  6.02

Basic residues  2

Acidic residues  2

Hydrophobic residues  9

Net charge  0

Boman Index  -1419

Hydrophobicity  45.81

Aliphatic Index  75.48

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  3355

Absorbance 280nm  111.83

Polar residues  15

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Novel cyclotides from Hedyotis biflora inhibit proliferation and migration of pancreatic cancer cell in vitro and in vivo

Doi 10.1007/s00044-013-0746-6

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.