This work is licensed under a Creative Commons Attribution 4.0 International License.
B8
General Information
DRACP ID DRACP01183
Peptide Name B8
Sequence GIPCGESCAFLPCLTSLLGCTCQNKVCYRD
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Hedyotis biflora
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| BxPC-3 | Pancreatic ductal adenocarcinoma | Carcinoma | IC50=3.11 μM | MTT assay | 72h | Patent |
| Capan-2 | Pancreatic ductal adenocarcinoma | Carcinoma | IC50=2.14 μM | MTT assay | 72h | Patent |
| MOH-1 | Pancreatic adenocarcinoma | Carcinoma | IC50=1.88 μM | MTT assay | 72h | Patent |
| PANC-1 | Pancreatic ductal adenocarcinoma | Carcinoma | IC50=1.95 μM | MTT assay | 72h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C134H216N36O42S6
Absent amino acids HMW
Common amino acids C
Mass 371324
Pl 6.03
Basic residues 2
Acidic residues 2
Hydrophobic residues 8
Net charge 0
Boman Index -1633
Hydrophobicity 41.33
Aliphatic Index 78
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1865
Absorbance 280nm 64.31
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Novel cyclotides from Hedyotis biflora inhibit proliferation and migration of pancreatic cancer cell in vitro and in vivo
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.