This work is licensed under a Creative Commons Attribution 4.0 International License.
Sequence 14 from Patent US 20030077289
General Information
DRACP ID DRACP01235
Peptide Name Sequence 14 from Patent US 20030077289
Sequence KKKKKKGGFLGFWRGENGRKTRSAYERMCNILKGK
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synthetic construct
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Antitumor
Structure Information
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Not available
C-terminal Modification Not available
Other Modification None
Chiral L
Physicochemical Information
Formula C182H303N59O45S2
Absent amino acids DHPQV
Common amino acids K
Mass 470851
Pl 11.55
Basic residues 13
Acidic residues 2
Hydrophobic residues 7
Net charge 11
Boman Index -10851
Hydrophobicity -140.86
Aliphatic Index 36.29
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 6990
Absorbance 280nm 205.59
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US 2003/0077289 A1
Patent Title Use of cell-penetrating peptides to generate antitumor immunity.
Other Iinformation Granted Patent Family: 6s / 6ex; Family Jurisdictions: CN, WO, AU, US; Legal Status: Discontinued; Application No: 7755502; Filed:Feb 15, 2002; Published: Apr 24, 2003; Earliest Priority: Feb 15, 2001
Other Published ID CN1309417C CN1503628A WO2002064057A2 WO2002064057A3
This work is licensed under a Creative Commons Attribution 4.0 International License.