This work is licensed under a Creative Commons Attribution 4.0 International License.
Sequence 4 from Patent US 20060252676
General Information
DRACP ID DRACP01290
Peptide Name Sequence 4 from Patent US 20060252676
Sequence MVRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGGLEHHHHHH
Sequence Length 75
UniProt ID Not available
PubChem CID Not available
Origin Scorpion
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Antitumor
Structure Information
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Not available
C-terminal Modification Not available
Other Modification None
Chiral L
Physicochemical Information
Formula C366H536N110O107S9
Absent amino acids T
Common amino acids GC
Mass 979767
Pl 7.4
Basic residues 15
Acidic residues 9
Hydrophobic residues 17
Net charge 6
Boman Index -14636
Hydrophobicity -78
Aliphatic Index 44.27
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 20440
Absorbance 280nm 276.22
Polar residues 29
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US 2006/0252676 A1
Patent Title Analgesic antitumor peptide from scorpion and method of producing it.
Other Iinformation Granted Patent Family: 10s / 10ex; Family Jurisdictions: US, DE, AT, CN, EP, WO; Legal Status: Active; Application No: 49107704; Filed:Dec 13, 2004; Published: Nov 9, 2006; Earliest Priority: Sep 30, 2001; Granted: Sep 22, 2009
Other Published ID CN1325514C CN1341662A DE60233064D1 EP1443053A1 EP1443053A4 EP1443053B1 US7592309 WO2003037922A1
This work is licensed under a Creative Commons Attribution 4.0 International License.