Sequence 1 from Patent US 20060252676

General Information


DRACP ID  DRACP01291

Peptide Name   Sequence 1 from Patent US 20060252676

Sequence  VRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG

Sequence Length  66

UniProt ID  Q95P69  Q9GNG8 

PubChem CID  Not available

Origin  Scorpion

Type  Native peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Antitumor



Structure Information


PDB ID  Not available

Predicted Structure  DRACP01291

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C314H467N89O96S8

Absent amino acids  HMT

Common amino acids  GC

Mass  844081

Pl  7.6

Basic residues  9

Acidic residues  8

Hydrophobic residues  16

Net charge  1

Boman Index  -11886

Hydrophobicity  -62.88

Aliphatic Index  44.39

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  20440

Absorbance 280nm  314.46

Polar residues  29

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2006/0252676 A1

Patent Title  Analgesic antitumor peptide from scorpion and method of producing it.

Other Iinformation  Granted Patent Family: 10s / 10ex; Family Jurisdictions: US, DE, AT, CN, EP, WO; Legal Status: Active; Application No: 49107704; Filed:Dec 13, 2004; Published: Nov 9, 2006; Earliest Priority: Sep 30, 2001; Granted: Sep 22, 2009

Other Published ID  CN1325514C  CN1341662A  DE60233064D1  EP1443053A1  EP1443053A4  EP1443053B1  US7592309  WO2003037922A1 




DRACP is developed by Dr.Zheng's team.