This work is licensed under a Creative Commons Attribution 4.0 International License.
LSB-37
General Information
DRACP ID DRACP01732
Peptide Name LSB-37
Sequence LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
Sequence Length 38
UniProt ID Not available
PubChem CID Not available
Origin FLAK peptides
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | LD50=50 µg/ml | MTT assay | 24 h | Patent |
| SW480 | Colon adenocarcinoma | Carcinoma | LD50=240 µg/ml | MTT assay | 24 h | Patent |
| BMKC | Skin carcinoma | Carcinoma | LD50=170 µg/ml | MTT assay | 24 h | Patent |
| NCI-H1299 | Lung large cell carcinoma | Carcinoma | LD50=120 µg/ml | MTT assay | 24 h | Patent |
| PC-3 | Prostate carcinoma | Carcinoma | LD50=370 µg/ml | MTT assay | 24 h | Patent |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | LD50=250 µg/ml | MTT assay | 24 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C189H322N54O45
Absent amino acids CDHMQSTY
Common amino acids K
Mass 473114
Pl 11.49
Basic residues 9
Acidic residues 2
Hydrophobic residues 18
Net charge 7
Boman Index -2593
Hydrophobicity 4.21
Aliphatic Index 115.53
Half Life
Mammalian: 5.5 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 148.65
Polar residues 7
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2005/0209157A1
Patent Title Short bioactive peptides and methods for their use
Other Iinformation Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.