SB-37 AC

General Information


DRACP ID  DRACP01734

Peptide Name   SB-37 AC

Sequence  MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG

Sequence Length  38

UniProt ID  Not available

PubChem CID  Not available

Origin  FLAK peptides

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
MCF-7 Invasive breast carcinoma of no special type Carcinoma LD50=175 µg/ml MTT assay 24 h Patent
SW480 Colon adenocarcinoma Carcinoma LD50=82 µg/ml MTT assay 24 h Patent
BMKC Skin carcinoma Carcinoma LD50=120 µg/ml MTT assay 24 h Patent
NCI-H1299 Lung large cell carcinoma Carcinoma LD50=220 µg/ml MTT assay 24 h Patent
PC-3 Prostate carcinoma Carcinoma Not available MTT assay 24 h Patent
HeLa Human papillomavirus-related endocervical adenocarcinoma Carcinoma LD50=150 µg/ml MTT assay 24 h Patent

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Antifungal



Structure Information


PDB ID  Not available

Predicted Structure  DRACP01734

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C188H320N54O45S

Absent amino acids  CDHQSTY

Common amino acids  K

Mass  474917

Pl  11.49

Basic residues  9

Acidic residues  2

Hydrophobic residues  17

Net charge  7

Boman Index  -2850

Hydrophobicity  -0.79

Aliphatic Index  105.26

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  148.65

Polar residues  7

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US2005/0209157A1

Patent Title  Short bioactive peptides and methods for their use

Other Iinformation  Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.