SB-37 AM
General Information
DRACP ID DRACP01735
Peptide Name SB-37 AM
Sequence MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
Sequence Length 38
UniProt ID Not available
PubChem CID Not available
Origin FLAK peptides
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | LD50=540 µg/ml | MTT assay | 24 h | Patent |
| SW480 | Colon adenocarcinoma | Carcinoma | LD50=1000 µg/ml | MTT assay | 24 h | Patent |
| BMKC | Skin carcinoma | Carcinoma | LD50=1000 µg/ml | MTT assay | 24 h | Patent |
| NCI-H1299 | Lung large cell carcinoma | Carcinoma | LD50=720 µg/ml | MTT assay | 24 h | Patent |
| PC-3 | Prostate carcinoma | Carcinoma | LD50=630 µg/ml | MTT assay | 24 h | Patent |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | LD50=1000 µg/ml | MTT assay | 24 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C188H320N54O45S
Absent amino acids CDHQSTY
Common amino acids K
Mass 474917
Pl 11.49
Basic residues 9
Acidic residues 2
Hydrophobic residues 17
Net charge 7
Boman Index -2850
Hydrophobicity -0.79
Aliphatic Index 105.26
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 148.65
Polar residues 7
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2005/0209157A1
Patent Title Short bioactive peptides and methods for their use
Other Iinformation Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001
Other Published ID Not available