K5(3-89 ActiveZone)frag SEQ ID NO: 1

General Information


DRACP ID  DRACP01765

Peptide Name   K5(3-89 ActiveZone)frag SEQ ID NO: 1

Sequence  EDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPKS

Sequence Length  87

UniProt ID  P00747 

PubChem CID  Not available

Origin  Not available

Type  Synthetic peptide

Classification

  

Active ACP Cancer targeted peptides



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
BT-549 Invasive breast carcinoma of no special type Carcinoma Proliferation Inhibition (5 day) IC50>20000 nM WST-8 assay 5 days Patent
U-118MG Astrocytoma Carcinoma Proliferation Inhibition (5 day) IC50=49 nM WST-8 assay 5 days Patent
4T1 Malignant neoplasms of the mouse mammary gland Carcinoma Proliferation Inhibition (5 day) IC50=12529 nM WST-8 assay 5 days Patent
DA-3 [Mouse lymphoma] Mouse lymphoma Lymphoma Proliferation Inhibition (5 day) IC50=10 nM WST-8 assay 5 days Patent
DLD-1 Colon adenocarcinoma Carcinoma Proliferation Inhibition (5 day) IC50=380 nM WST-8 assay 5 days Patent
D-54MG Glioblastoma Blastoma When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 5, 12 ± 6, 56 ± 5. WST-8 assay 72 h Patent
Calu-6 Lung adenocarcinoma Carcinoma When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 7 ± 2, 21 ± 3, 30 ± 4. WST-8 assay 72 h Patent
MDA-MB-231 Breast adenocarcinoma Carcinoma When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 2 ± 4, 13 ± 2, 46 ± 6. WST-8 assay 72 h Patent
U-87MG ATCC Glioblastoma Blastoma When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 4, 24 ± 5, 64 ± 8. WST-8 assay 72 h Patent
HT-29 Colon adenocarcinoma Carcinoma When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 2, 10 ± 8, 0 ± 10. WST-8 assay 72 h Patent

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  293 Kidney fibroblasts: When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 8, 0 ± 10, 0 ± 6.

Target  tyrosine kinase orphan receptors (RORs)

Affinity  Not available

Mechanism  Not available

Nature  Anticancer



Structure Information


PDB ID  Not available

Predicted Structure  DRACP01765

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C417H628N124O131S7

Absent amino acids 

Common amino acids  GPT

Mass  1123289

Pl  7.77

Basic residues  13

Acidic residues  10

Hydrophobic residues  16

Net charge  3

Boman Index  -21718

Hydrophobicity  -105.06

Aliphatic Index  30.34

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  18825

Absorbance 280nm  218.9

Polar residues  35

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US2019/0142913A1

Patent Title  Grp78 Antagonist That Block Binding of Receptor Tyrosine Kinase Orphan Receptors as Immunotherapy Anticancer Agents

Other Iinformation  Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Active; Application No: 201816184247; Filed: Nov 8, 2018; Published: May 16, 2019; Earliest Priority: Nov 10, 2017; Granted: Feb 2, 2021

Other Published ID  US10905750B2  




DRACP is developed by Dr.Zheng's team.