This work is licensed under a Creative Commons Attribution 4.0 International License.
Kr1(1-91 ActiveZone)frag SEQ ID NO: 19
General Information
DRACP ID DRACP01767
Peptide Name Kr1(1-91 ActiveZone)frag SEQ ID NO: 19
Sequence GSNKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDS
Sequence Length 91
UniProt ID Q01973
PubChem CID Not available
Origin Not available
Type Synthetic peptide
Classification
Active ACP Cancer targeted peptides
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| BT-549 | Invasive breast carcinoma of no special type | Carcinoma | Proliferation Inhibition (5 day) IC50=14400 nM | WST-8 assay | 5 days | Patent |
| U-118MG | Astrocytoma | Carcinoma | Proliferation Inhibition (5 day) IC50=20 nM | WST-8 assay | 5 days | Patent |
| 4T1 | Malignant neoplasms of the mouse mammary gland | Carcinoma | Proliferation Inhibition (5 day) IC50=3254 nM | WST-8 assay | 5 days | Patent |
| DA-3 [Mouse lymphoma] | Mouse lymphoma | Lymphoma | Proliferation Inhibition (5 day) IC50=13 nM | WST-8 assay | 5 days | Patent |
| DLD-1 | Colon adenocarcinoma | Carcinoma | Proliferation Inhibition (5 day) IC50=250 nM | WST-8 assay | 5 days | Patent |
| D-54MG | Glioblastoma | Blastoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 15 ± 3, 52 ± 6, 85 ± 3. | WST-8 assay | 72 h | Patent |
| Calu-6 | Lung adenocarcinoma | Carcinoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 14 ± 2, 31 ± 5, 60 ± 5. | WST-8 assay | 72 h | Patent |
| MDA-MB-231 | Breast adenocarcinoma | Carcinoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 33 ± 8, 63 ± 12, 86 ± 10. | WST-8 assay | 72 h | Patent |
| U-87MG ATCC | Glioblastoma | Blastoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 12 ± 7, 45 ± 7, 82 ± 8. | WST-8 assay | 72 h | Patent |
| HT-29 | Colon adenocarcinoma | Carcinoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 8, 10 ± 9, 0 ± 5. | WST-8 assay | 72 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity 293 Kidney fibroblasts: When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 5, 0 ± 6, 0 ± 7.
Target tyrosine kinase orphan receptors (RORs)
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C440H657N131O142S6
Absent amino acids M
Common amino acids SN
Mass 1185168
Pl 7.81
Basic residues 14
Acidic residues 9
Hydrophobic residues 17
Net charge 5
Boman Index -23581
Hydrophobicity -104.73
Aliphatic Index 34.29
Half Life
Mammalian: 1 hour
Yeast: 30 min
E.coli: >10 hour
Extinction Coefficient cystines 17335
Absorbance 280nm 192.61
Polar residues 41
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2019/0142913A1
Patent Title Grp78 Antagonist That Block Binding of Receptor Tyrosine Kinase Orphan Receptors as Immunotherapy Anticancer Agents
Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Active; Application No: 201816184247; Filed: Nov 8, 2018; Published: May 16, 2019; Earliest Priority: Nov 10, 2017; Granted: Feb 2, 2021
Other Published ID US10905750B2
This work is licensed under a Creative Commons Attribution 4.0 International License.