This work is licensed under a Creative Commons Attribution 4.0 International License.
Kr1(3-91 ActiveZone)frag-Fc SEQ ID NO: 20
General Information
DRACP ID DRACP01768
Peptide Name Kr1(3-91 ActiveZone)frag-Fc SEQ ID NO: 20
Sequence NHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSCD
Sequence Length 89
UniProt ID Q01973
PubChem CID Not available
Origin Not available
Type Synthetic peptide
Classification
Active ACP Cancer targeted peptides
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| BT-549 | Invasive breast carcinoma of no special type | Carcinoma | Proliferation Inhibition (5 day) IC50=13 nM | WST-8 assay | 5 days | Patent |
| U-118MG | Astrocytoma | Carcinoma | Proliferation Inhibition (5 day) IC50=1.4 nM | WST-8 assay | 5 days | Patent |
| 4T1 | Malignant neoplasms of the mouse mammary gland | Carcinoma | Proliferation Inhibition (5 day) IC50=7 nM | WST-8 assay | 5 days | Patent |
| DLD-1 | Colon adenocarcinoma | Carcinoma | Proliferation Inhibition (5 day) IC50=9 nM | WST-8 assay | 5 days | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target tyrosine kinase orphan receptors (RORs)
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C432H641N127O140S7
Absent amino acids M
Common amino acids SCDNT
Mass 1164784
Pl 6.88
Basic residues 13
Acidic residues 10
Hydrophobic residues 17
Net charge 3
Boman Index -22860
Hydrophobicity -98.54
Aliphatic Index 35.06
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 17335
Absorbance 280nm 196.99
Polar residues 39
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2019/0142913A1
Patent Title Grp78 Antagonist That Block Binding of Receptor Tyrosine Kinase Orphan Receptors as Immunotherapy Anticancer Agents
Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Active; Application No: 201816184247; Filed: Nov 8, 2018; Published: May 16, 2019; Earliest Priority: Nov 10, 2017; Granted: Feb 2, 2021
Other Published ID US10905750B2
This work is licensed under a Creative Commons Attribution 4.0 International License.