This work is licensed under a Creative Commons Attribution 4.0 International License.
vitri F
General Information
DRACP ID DRACP01844
Peptide Name vitri F
Sequence GTLPCGESCVWIPCISSVVGCACKSKVCYKD
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Viola tricolor
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=5.36 µg/ml | SRB assay | 48 h | 1 |
Hemolytic Activity HRBCs: HC50=10.00 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys19; Cys9<--->Cys21; Cys14<--->Cys26
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C138H223N35O42S6
Absent amino acids FHMNQR
Common amino acids C
Mass 377216
Pl 7.73
Basic residues 3
Acidic residues 2
Hydrophobic residues 9
Net charge 1
Boman Index -293
Hydrophobicity 55.48
Aliphatic Index 78.39
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 7365
Absorbance 280nm 245.5
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20580652
Title Isolation and characterization of cytotoxic cyclotides from Viola tricolor
Doi 10.1016/j.peptides.2010.05.004
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.