vitri A
General Information
DRACP ID DRACP01845
Peptide Name vitri A
Sequence GIPCGESCVWIPCITSAIGCSCKSKVCYRN
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Viola tricolor
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=4.94 µg/ml | SRB assay | 48 h | 1 |
Hemolytic Activity HRBCs: HC50=8.91 Μm
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C134H217N37O40S6
Absent amino acids DFHLMQ
Common amino acids C
Mass 369624
Pl 8.11
Basic residues 3
Acidic residues 1
Hydrophobic residues 8
Net charge 2
Boman Index -1338
Hydrophobicity 44.67
Aliphatic Index 74.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 16
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20580652
Title Isolation and characterization of cytotoxic cyclotides from Viola tricolor
Doi 10.1016/j.peptides.2010.05.004
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available