This work is licensed under a Creative Commons Attribution 4.0 International License.
FGR (7-22)-HEXIM1 (147-164), FGF-BR
General Information
DRACP ID DRACP01937
Peptide Name FGR (7-22)-HEXIM1 (147-164), FGF-BR
Sequence AAVALLPAVLLALLAPQLGKKKHRRRPSKKKRHW
Sequence Length 34
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HCT 116-/-p53 | Colon carcinoma | Carcinoma | 30%Killing=10 µM | CellTox cytotoxicity assay | 30 min | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HEK293: 30%Killing=10 µM; HFF: 20%Killing=10 µM; 90%Killing=50 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C178H308N58O37
Absent amino acids CDEFIMNTY
Common amino acids L
Mass 444159
Pl 13
Basic residues 12
Acidic residues 0
Hydrophobic residues 16
Net charge 12
Boman Index -5459
Hydrophobicity -36.47
Aliphatic Index 115
Half Life
Mammalian: 4.4 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 166.67
Polar residues 2
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26734838
Title Use of a novel cytotoxic HEXIM1 peptide in the directed breast cancer therapy
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_12679
This work is licensed under a Creative Commons Attribution 4.0 International License.