FGR (7-22)-HEXIM1 (147-164)[K6I,H7L][R8,9A], FGF-BR(ILAA)

General Information


DRACP ID  DRACP01944

Peptide Name   FGR (7-22)-HEXIM1 (147-164)[K6I,H7L][R8,9A], FGF-BR(ILAA)

Sequence  AAVALLPAVLLALLAPQLGKKILAARPSKKKRHW

Sequence Length  34

UniProt ID  O94992  P08620 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
HCT 116-/-p53 Colon carcinoma Carcinoma 65%Killing=10 µM; 100%Killing=50 µM CellTox cytotoxicity assay 30 min 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer



Structure Information


PDB ID  Not available

Predicted Structure  DRACP01944

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C172H297N49O37

Absent amino acids  CDEFMNTY

Common amino acids  AL

Mass  423240

Pl  12.57

Basic residues  8

Acidic residues  0

Hydrophobic residues  20

Net charge  8

Boman Index  -108

Hydrophobicity  45.88

Aliphatic Index  143.82

Half Life 
  Mammalian: 4.4 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  166.67

Polar residues  2

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 26734838

Title  Use of a novel cytotoxic HEXIM1 peptide in the directed breast cancer therapy

Doi 10.18632/oncotarget.6794

Year  2016

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPS_12686

DRACP is developed by Dr.Zheng's team.