This work is licensed under a Creative Commons Attribution 4.0 International License.
FGR (7-22)-HEXIM1 (147-164)[K6I,H7L][R8,9A], FGF-BR(ILAA)
General Information
DRACP ID DRACP01944
Peptide Name FGR (7-22)-HEXIM1 (147-164)[K6I,H7L][R8,9A], FGF-BR(ILAA)
Sequence AAVALLPAVLLALLAPQLGKKILAARPSKKKRHW
Sequence Length 34
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HCT 116-/-p53 | Colon carcinoma | Carcinoma | 65%Killing=10 µM; 100%Killing=50 µM | CellTox cytotoxicity assay | 30 min | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C172H297N49O37
Absent amino acids CDEFMNTY
Common amino acids AL
Mass 423240
Pl 12.57
Basic residues 8
Acidic residues 0
Hydrophobic residues 20
Net charge 8
Boman Index -108
Hydrophobicity 45.88
Aliphatic Index 143.82
Half Life
Mammalian: 4.4 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 166.67
Polar residues 2
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26734838
Title Use of a novel cytotoxic HEXIM1 peptide in the directed breast cancer therapy
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_12686
This work is licensed under a Creative Commons Attribution 4.0 International License.