This work is licensed under a Creative Commons Attribution 4.0 International License.
RNase 3 (1-36)[P3,Q4,L18,N19,P20,C23DEL], RN3(5-17P22-36)
General Information
DRACP ID DRACP01999
Peptide Name RNase 3 (1-36)[P3,Q4,L18,N19,P20,C23DEL], RN3(5-17P22-36)
Sequence RPFTRAQWFAIQHISPRTIAMRAINNYRWR
Sequence Length 30
UniProt ID P12724
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Hep-G2 | Hepatoblastoma | Blastoma | IC50=74.43±1.91 µM | MTT assay | 4 h | 1 |
Hemolytic Activity Sheep erythrocytes: 50% Hemolysis=178.33±81.72 µM; Horse erythrocytes: 44±4% Hemolysis=250 µM
Normal (non-cancerous) Cytotoxicity MRC-5: IC50>150 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C171H262N56O39S
Absent amino acids CDEGKLV
Common amino acids R
Mass 427581
Pl 12.8
Basic residues 7
Acidic residues 0
Hydrophobic residues 12
Net charge 7
Boman Index -8733
Hydrophobicity -66.67
Aliphatic Index 65.33
Half Life
Mammalian: 0.8 hour
Yeast: 10 min
E.coli: >10 hour
Extinction Coefficient cystines 12490
Absorbance 280nm 430.69
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29763807
Title Positional scanning library applied to the human eosinophil cationic protein/RNase3 N-terminus reveals novel and potent anti-biofilm peptides
Doi 10.1016/j.ejmech.2018.05.012
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_14140
This work is licensed under a Creative Commons Attribution 4.0 International License.