This work is licensed under a Creative Commons Attribution 4.0 International License.
RN3(5-17P22-36)[Q12I]
General Information
DRACP ID DRACP02002
Peptide Name RN3(5-17P22-36)[Q12I]
Sequence RPFTRAQWFAIIHISPRTIAMRAINNYRWR
Sequence Length 30
UniProt ID P12724
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Hep-G2 | Hepatoblastoma | Blastoma | IC50=59.64±6.17 µM | MTT assay | 4 h | 1 |
Hemolytic Activity Sheep erythrocytes: 50% Hemolysis>100µM
Normal (non-cancerous) Cytotoxicity MRC-5: IC50>100 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C172H265N55O38S
Absent amino acids CDEGKLV
Common amino acids R
Mass 426084
Pl 12.8
Basic residues 7
Acidic residues 0
Hydrophobic residues 13
Net charge 7
Boman Index -7687
Hydrophobicity -40
Aliphatic Index 78.33
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 12490
Absorbance 280nm 430.69
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29763807
Title Positional scanning library applied to the human eosinophil cationic protein/RNase3 N-terminus reveals novel and potent anti-biofilm peptides
Doi 10.1016/j.ejmech.2018.05.012
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_14143
This work is licensed under a Creative Commons Attribution 4.0 International License.