This work is licensed under a Creative Commons Attribution 4.0 International License.
APETx4
General Information
DRACP ID DRACP02004
Peptide Name APETx4
Sequence GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD
Sequence Length 42
UniProt ID C0HL40
PubChem CID Not available
Origin Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima)
Type Native peptide
Classification
Active ACP KV10.1 inhibitor
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MDA-MB-435S | Amelanotic melanoma | Carcinoma | KV10.1 Expression Level: Moderate | CellTox Green Dye assay | Not available | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity NIH-3T3: KV10.1 Expression Level (Undetectable); Human epithelial cell line hTERT RPE-1: KV10.1 Expression Level (Moderate)
Target Not available
Affinity Not available
Mechanism APETx4 is able to selectively inhibit the human ether-à-go-go channel (hEag1 or KV10.1), which a cancer-relevant voltage-gated potassium channel that is overexpressed in a majority of human tumors.
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C211H301N49O59S6
Absent amino acids AEHMQ
Common amino acids G
Mass 539185
Pl 8.1
Basic residues 3
Acidic residues 1
Hydrophobic residues 8
Net charge 2
Boman Index -1560
Hydrophobicity 3.33
Aliphatic Index 44.05
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 14815
Absorbance 280nm 361.34
Polar residues 27
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28902151
Title APETx4, a Novel Sea Anemone Toxin and a Modulator of the Cancer-Relevant Potassium Channel KV10.1
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.