This work is licensed under a Creative Commons Attribution 4.0 International License.
ABP-CM4
General Information
DRACP ID DRACP02276
Peptide Name ABP-CM4
Sequence RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
Sequence Length 35
UniProt ID P14666
PubChem CID Not available
Origin Bombyx mori
Type Native peptide
Classification
Active ACP Membrane lysis
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Leukemia | IC50=14.2 µM | MTT assay | 24 h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | Leukemia | IC50=15.8 µM | MTT assay | 24 h | 1 |
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | IC50=17.5 µM | MTT assay | 24 h | 1 |
Hemolytic Activity Human erythrocytes: Not active up to 200 µM
Normal (non-cancerous) Cytotoxicity HEK293: Not active up to 80 µM; Human PBMC: Not active up to 80 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C172H290N50O44
Absent amino acids CHLMSY
Common amino acids AIKV
Mass 436917
Pl 11.34
Basic residues 7
Acidic residues 2
Hydrophobic residues 17
Net charge 5
Boman Index -3049
Hydrophobicity 12.86
Aliphatic Index 111.43
Half Life
Mammalian: 20 hour
Yeast: 30 min
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 161.76
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20493915
Title A cationic amphiphilic peptide ABP-CM4 exhibits selective cytotoxicity against leukemia cells
Doi 10.1016/j.peptides.2010.05.010
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_3460
This work is licensed under a Creative Commons Attribution 4.0 International License.