This work is licensed under a Creative Commons Attribution 4.0 International License.
PvD1, Defensin D1
General Information
DRACP ID DRACP02324
Peptide Name PvD1, Defensin D1
Sequence KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC
Sequence Length 47
PubChem CID Not available
Origin Phaseolus vulgaris
Type Native peptide
Classification
Active ACP Induce apoptosis
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MDA-MB-231 | Breast adenocarcinoma | Carcinoma | IC50=0.82±0.14 µM | MTT assay | 24 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity MCF-10a: 50% Cell death=7 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys3<--->Cys47; Cys14<--->Cys35; Cys20<--->Cys41; Cys24<--->Cys43
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C222H346N72O73S8
Absent amino acids IMQV
Common amino acids C
Mass 626880
Pl 7.98
Basic residues 11
Acidic residues 7
Hydrophobic residues 6
Net charge 4
Boman Index -16068
Hydrophobicity -114.89
Aliphatic Index 18.72
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 7490
Absorbance 280nm 162.83
Polar residues 22
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29076508
Title Challenging metastatic breast cancer with the natural defensin PvD1
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4120
This work is licensed under a Creative Commons Attribution 4.0 International License.