This work is licensed under a Creative Commons Attribution 4.0 International License.
SPP-1
General Information
DRACP ID DRACP02346
Peptide Name SPP-1
Sequence GNPANPLNLKKHHGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLCWTMLLPLHHECEEELKKVKKELKKDIENKDSPDKACKDVDLC
Sequence Length 89
UniProt ID Q22291
PubChem CID Not available
Origin Caenorhabditis elegans
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Jurkat | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | Leukemia | Low active up to 10 µM | Fluorescent dye SYTOX Green assay | Not available | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys17<--->Cys89; Cys20<--->Cys83; Cys47<--->Cys58
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C434H697N117O136S7
Absent amino acids QRY
Common amino acids KL
Mass 1152436
Pl 4.91
Basic residues 17
Acidic residues 19
Hydrophobic residues 28
Net charge -2
Boman Index -15522
Hydrophobicity -55.51
Aliphatic Index 88.65
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 11375
Absorbance 280nm 129.26
Polar residues 20
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22519640
Title The saposin-like protein SPP-12 is an antimicrobial polypeptide in the pharyngeal neurons of Caenorhabditis elegans and participates in defence against a natural bacterial pathogen
Year 2012
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_4295
This work is licensed under a Creative Commons Attribution 4.0 International License.