Peptide Libraray

SPP-12

General Information

DRACP ID DRACP02347

Peptide Name SPP-12

Sequence GSHGAFCHLCEDLIKDGKEAGDVALDVWLDEEIGSRCKDFGVLASECFKELKVAEHDIWEAIDQEIPEDKTCKEAKLC

Sequence Length 78

UniProt ID Q9XVI5

PubChem CID Not available

Origin Caenorhabditis elegans

Type Native peptide

Classification

Active ACP

Activity Information

Cell Line	Disease	Cancer Classified	Activity	Assay	Testing Time	Literature
Jurkat	Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia	Leukemia	Low active up to 10 µM	Fluorescent dye SYTOX Green assay	Not available	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Nature Anticancer; Antibacterial; Antifungal

Structure Information

PDB ID Not available

Predicted Structure DRACP02347

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys7<--->Cys78; Cys10<--->Cys72; Cys37<--->Cys47

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C378H588N98O124S6

Absent amino acids MNY

Common amino acids E

Mass 1005548

Pl 4.21

Basic residues 12

Acidic residues 20

Hydrophobic residues 28

Net charge -8

Boman Index -13021

Hydrophobicity -33.08

Aliphatic Index 83.85

Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour

Extinction Coefficient cystines 11375

Absorbance 280nm 147.73

Polar residues 16

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 22519640

Title The saposin-like protein SPP-12 is an antimicrobial polypeptide in the pharyngeal neurons of Caenorhabditis elegans and participates in defence against a natural bacterial pathogen

Doi 10.1042/BJ20112102

Year 2012

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID DBAASPS_4296