This work is licensed under a Creative Commons Attribution 4.0 International License.
Crotamine
General Information
DRACP ID DRACP02361
Peptide Name Crotamine
Sequence YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
Sequence Length 42
UniProt ID Q9PWF3
PubChem CID Not available
Origin Crotalus durissus terrificus
Type Native peptide
Classification
Active ACP Cell-penetrating peptides
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| CHO-K1 | Ovary tumor | Carcinoma | IC50=5 µM | MTT assay | 24 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HEK293: 50% Cell death>50 µM; BMDMs: 3% Cell death=50 µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys36; Cys11<--->Cys30; Cys18<--->Cys37
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C214H332N64O54S7
Absent amino acids ANTV
Common amino acids K
Mass 562130
Pl 9.86
Basic residues 13
Acidic residues 3
Hydrophobic residues 6
Net charge 10
Boman Index -9405
Hydrophobicity -109.52
Aliphatic Index 18.57
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 12865
Absorbance 280nm 313.78
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18662711
Title Cytotoxic effects of crotamine are mediated through lysosomal membrane permeabilization
Doi 10.1016/j.toxicon.2008.06.029
Year 2008
Literature 2
Pubmed ID 23022146
Title Unraveling the antifungal activity of a South American rattlesnake toxin crotamine
Doi Unraveling the antifungal activity of a South American rattlesnake toxin crotamine
Year 2013
Literature 3
Pubmed ID 31994997
Title Effect of Isolated Proteins from Crotalus Durissus Terrificus Venom on Leishmania (Leishmania) Amazonensis-Infected Macrophages
Doi 10.2174/0929866527666200129152954
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4321
This work is licensed under a Creative Commons Attribution 4.0 International License.