Psalmopeotoxin I, PcFK1

General Information


DRACP ID  DRACP02373

Peptide Name   Psalmopeotoxin I, PcFK1

Sequence  ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV

Sequence Length  33

UniProt ID  P0C201 

PubChem CID  Not available

Origin  Psalmopoeus cambridgei

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
HeLa 229 Human papillomavirus-related endocervical adenocarcinoma Carcinoma Not active up to 50 µM PI and Annexin-V-FITC double-staining 48 h 1

Hemolytic Activity  Human erythrocytes: Not active at 10 µM

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Antifungal



Structure Information


PDB ID  Not available

Predicted Structure  DRACP02373

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys2<--->Cys19; Cys9<--->Cys24; Cys18<--->Cys29

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C153H247N47O43S6

Absent amino acids  EFMSTW

Common amino acids  C

Mass  419630

Pl  8.12

Basic residues  4

Acidic residues  1

Hydrophobic residues  10

Net charge  3

Boman Index  -2899

Hydrophobicity  21.82

Aliphatic Index  88.48

Half Life 
  Mammalian:
  Yeast:
  E.coli:

Extinction Coefficient cystines  3355

Absorbance 280nm  104.84

Polar residues  13

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 15304333

Title  Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei

Doi 10.1016/j.febslet.2004.07.019

Year  2004

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPR_4467

DRACP is developed by Dr.Zheng's team.