Cathelicidin CATH2, Cc-CATH2
General Information
DRACP ID DRACP02375
Peptide Name Cathelicidin CATH2, Cc-CATH2
Sequence LVQRGRFGRFLKKVRRFIPKVIIAAQIGSRFG
Sequence Length 32
UniProt ID D1MJ08
PubChem CID Not available
Origin Coturnix coturnix
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| RAW 264.7 | Mouse leukemia | Leukemia | IC50=75 µg/ml | MTT assay | 48 h | 1 |
Hemolytic Activity Human erythrocytes: 4.1% Hemolysis=100 µg/ml
Normal (non-cancerous) Cytotoxicity HUVEC: IC50=75 µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C173H289N55O36
Absent amino acids CDEHMNTWY
Common amino acids R
Mass 426866
Pl 13.21
Basic residues 9
Acidic residues 0
Hydrophobic residues 15
Net charge 9
Boman Index -5971
Hydrophobicity 10.31
Aliphatic Index 106.56
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 5
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21375690
Title Gene cloning, expression and characterization of avian cathelicidin orthologs, Cc-CATHs, from Coturnix coturnix
Doi 10.1111/j.1742-4658.2011.08080.x
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4478