This work is licensed under a Creative Commons Attribution 4.0 International License.
cHLH-pDI1-R
General Information
DRACP ID DRACP02845
Peptide Name cHLH-pDI1-R
Sequence GARELRRLERELRRLEKGGGGGGKLAALTFEHYWAQLTSC
Sequence Length 40
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP Membrane lysis Cell-penetrating peptides
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MM96L | Melanoma | Carcinoma | CC50>64 μM | Resazurin assay | 26 h | 1 |
| MDA-MB-435S | Amelanotic melanoma | Carcinoma | CC50>64 μM | Resazurin assay | 26 h | 1 |
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | CC50>64 μM | Resazurin assay | 26 h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | Leukemia | CC50>64 μM | Resazurin assay | 26 h | 1 |
Hemolytic Activity Human erythrocytes: 50% Hemolysis>64 µM
Normal (non-cancerous) Cytotoxicity HFF-1: CC50>64 µM; MCF-10A: CC50>64 µM; Human PBMC: CC50>64 µM
Target Not available
Affinity Not available
Mechanism (1) The positively charged peptide targets the negative surface of cancer cells via electrostatic attractions; (2) The peptide inserts into cell membranes and enters inside cells very efficaciously; (3) Once inside cells, the peptide induces toxicity through fusion and/or disruption of intracellular organelles; (4) The cell membrane is disrupted and the cells die.
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond TIE: N-terminal Chloroacetic acid<--->Cys39
N-terminal Modification CAA, Chloroacetic acid
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C195H318N64O56S
Absent amino acids DIMNPV
Common amino acids GL
Mass 518295
Pl 10.24
Basic residues 9
Acidic residues 5
Hydrophobic residues 13
Net charge 4
Boman Index -9870
Hydrophobicity -67.75
Aliphatic Index 78.25
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 6990
Absorbance 280nm 179.23
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31390185
Title Cell Membrane Composition Drives Selectivity and Toxicity of Designed Cyclic Helix-Loop-Helix Peptides with Cell Penetrating and Tumor Suppressor Properties
Doi 10.1021/acschembio.9b00593
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_17188
This work is licensed under a Creative Commons Attribution 4.0 International License.