CEN1 HC (Ser)
General Information
DRACP ID DRACP02888
Peptide Name CEN1 HC (Ser)
Sequence GWFKKTFHKVSHAVKSGIHAGQRGSSALGF
Sequence Length 30
UniProt ID D8WN02
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Leukemia | Weak active up to 125 mg/L | MTT assay | 6 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Anti-inflammatory
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C148H225N45O37
Absent amino acids CDEMNPY
Common amino acids G
Mass 374414
Pl 12
Basic residues 8
Acidic residues 0
Hydrophobic residues 11
Net charge 8
Boman Index -3349
Hydrophobicity -31.67
Aliphatic Index 55.33
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 189.66
Polar residues 10
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 23237525
Title Anti-infectious and anti-inflammatory effects of peptide fragments sequentially derived from the antimicrobial peptide centrocin 1 isolated from the green sea urchin, Strongylocentrotus droebachiensis
Year 2012
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_17827