CEN1 HC (Ser)

General Information


DRACP ID  DRACP02888

Peptide Name   CEN1 HC (Ser)

Sequence  GWFKKTFHKVSHAVKSGIHAGQRGSSALGF

Sequence Length  30

UniProt ID  D8WN02 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
THP-1 Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia Leukemia Weak active up to 125 mg/L MTT assay 6 h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Anti-inflammatory



Structure Information


PDB ID  Not available

Predicted Structure  DRACP02888

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C148H225N45O37

Absent amino acids  CDEMNPY

Common amino acids  G

Mass  374414

Pl  12

Basic residues  8

Acidic residues  0

Hydrophobic residues  11

Net charge  8

Boman Index  -3349

Hydrophobicity  -31.67

Aliphatic Index  55.33

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  189.66

Polar residues  10

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 23237525

Title  Anti-infectious and anti-inflammatory effects of peptide fragments sequentially derived from the antimicrobial peptide centrocin 1 isolated from the green sea urchin, Strongylocentrotus droebachiensis

Doi 10.1186/2191-0855-2-67

Year  2012

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPS_17827

DRACP is developed by Dr.Zheng's team.