This work is licensed under a Creative Commons Attribution 4.0 International License.
Defensin MGD-1
General Information
DRACP ID DRACP03440
Peptide Name Defensin MGD-1
Sequence GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
Sequence Length 38
UniProt ID P80571
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antiparasitic; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C181H270N64O47S8
Absent amino acids ADEMV
Common amino acids C
Mass 501117
Pl 8.78
Basic residues 9
Acidic residues 0
Hydrophobic residues 4
Net charge 9
Boman Index -8737
Hydrophobicity -72.89
Aliphatic Index 20.53
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 10470
Absorbance 280nm 282.97
Polar residues 22
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 12823551
Title Key role of the loop connecting the two beta strands of mussel defensin in its antimicrobial activity
Doi Not available
Year 2003
Literature 2
Pubmed ID 8925841
Title A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis)
Doi Not available
Year 1996
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 2538
This work is licensed under a Creative Commons Attribution 4.0 International License.