This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin-B, Cecropin XJ
General Information
DRACP ID DRACP03489
Peptide Name Cecropin-B, Cecropin XJ
Sequence RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAI
Sequence Length 35
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C177H302N52O44S
Absent amino acids CHQTY
Common amino acids IK
Mass 450138
Pl 11.39
Basic residues 9
Acidic residues 3
Hydrophobic residues 15
Net charge 6
Boman Index -4926
Hydrophobicity -13.43
Aliphatic Index 106
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 161.76
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31045339
Title Enhanced Silkworm Cecropin B Antimicrobial Activity against Pseudomonas aeruginosa from Single Amino Acid Variation
Doi Not available
Year 2019
Literature 2
Pubmed ID 23500722
Title Expression, purification and characterization of cecropin antibacterial peptide from Bombyx mori in Saccharomyces cerevisiae
Doi Not available
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 5349
This work is licensed under a Creative Commons Attribution 4.0 International License.