This work is licensed under a Creative Commons Attribution 4.0 International License.
Cathelicidin-like peptide, Crotalicidin
General Information
DRACP ID DRACP03491
Peptide Name Cathelicidin-like peptide, Crotalicidin
Sequence KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF
Sequence Length 34
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antiparasitic; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C203H345N53O37S
Absent amino acids ACDEHNQWY
Common amino acids K
Mass 474113
Pl 12.66
Basic residues 15
Acidic residues 0
Hydrophobic residues 13
Net charge 15
Boman Index -5393
Hydrophobicity -43.53
Aliphatic Index 80
Half Life
Mammalian: 2.8 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 3
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29208061
Title Antichagasic effect of crotalicidin, a cathelicidin-like vipericidin, found in Crotalus durissus terrificus rattlesnake's venom gland
Doi Not available
Year 2017
Literature 2
Pubmed ID 27876749
Title Anti-fungal activity of Ctn[15-34], the C-terminal peptide fragment of crotalicidin, a rattlesnake venom gland cathelicidin
Doi Not available
Year 2016
Literature 3
Pubmed ID 26465972
Title Structural Dissection of Crotalicidin, a Rattlesnake Venom Cathelicidin, Retrieves a Fragment with Antimicrobial and Antitumor Activity
Doi Not available
Year 2015
Literature 4
Pubmed ID 25100358
Title Vipericidins: a novel family of cathelicidin-related peptides from the venom gland of South American pit vipers
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 5383
This work is licensed under a Creative Commons Attribution 4.0 International License.