This work is licensed under a Creative Commons Attribution 4.0 International License.
Enfuvirtide, ENF, T-20, Fuzeon, DP-178
General Information
DRACP ID DRACP03511
Peptide Name Enfuvirtide, ENF, T-20, Fuzeon, DP-178
Sequence YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Sequence Length 36
UniProt ID P04578
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C202H298N50O64
Absent amino acids CGMPRV
Common amino acids EL
Mass 507536
Pl 4.02
Basic residues 3
Acidic residues 7
Hydrophobic residues 13
Net charge -4
Boman Index -7259
Hydrophobicity -87.5
Aliphatic Index 89.44
Half Life
Mammalian: 2.8 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 17990
Absorbance 280nm 514
Polar residues 9
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30716118
Title Monotherapy With a Low-Dose Lipopeptide HIV Fusion Inhibitor Maintains Long-Term Viral Suppression in Rhesus Macaques
Doi Not available
Year 2019
Literature 2
Pubmed ID 30867304
Title Design and Characterization of Cholesterylated Peptide HIV-1/2 Fusion Inhibitors With Extremely Potent and Long-Lasting Antiviral Activity
Doi Not available
Year 2019
Literature 3
Pubmed ID 31228294
Title Optimization of Peptidic HIV-1 Fusion Inhibitor T20 by Phage Display
Doi Not available
Year 2019
Literature 4
Pubmed ID 31805154
Title IgG Fc-binding Motif-Conjugated HIV-1 Fusion Inhibitor Exhibits Improved Potency and in Vivo Half-Life: Potential Application in Combination With Broad Neutralizing Antibodies
Doi Not available
Year 2019
Literature 5
Pubmed ID 31932193
Title Suitable Fusion of N-terminal Heptad Repeats to Achieve Covalently Stabilized Potent N-peptide Inhibitors of HIV-1 Infection
Doi Not available
Year 2020
Literature 6
Pubmed ID 27795416
Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors
Doi Not available
Year 2016
Literature 7
Pubmed ID 19073606
Title Design of peptide-based inhibitors for human immunodef
Year
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 6056
This work is licensed under a Creative Commons Attribution 4.0 International License.