This work is licensed under a Creative Commons Attribution 4.0 International License.
Carnobacteriocin BM1
General Information
DRACP ID DRACP03522
Peptide Name Carnobacteriocin BM1
Sequence AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH
Sequence Length 43
UniProt ID P38579
PubChem CID Not available
Origin Bacteria
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C199H310N56O59S3
Absent amino acids DFPR
Common amino acids G
Mass 527653
Pl 8.76
Basic residues 5
Acidic residues 2
Hydrophobic residues 15
Net charge 3
Boman Index -2371
Hydrophobicity -7.67
Aliphatic Index 77.21
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 14105
Absorbance 280nm 335.83
Polar residues 19
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 19271288
Title Interactions between two carnobacteriocins Cbn BM1 and Cbn B2 from Carnobacterium maltaromaticum CP5 on target bacteria and Caco-2 cells
Doi Not available
Year 2009
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 6216
This work is licensed under a Creative Commons Attribution 4.0 International License.