This work is licensed under a Creative Commons Attribution 4.0 International License.
Carnobacteriocin B2
General Information
DRACP ID DRACP03523
Peptide Name Carnobacteriocin B2
Sequence VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
Sequence Length 48
UniProt ID P38580
PubChem CID Not available
Origin Bacteria
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C213H332N66O68S2
Absent amino acids DHLM
Common amino acids G
Mass 580799
Pl 9.96
Basic residues 5
Acidic residues 1
Hydrophobic residues 14
Net charge 4
Boman Index -7388
Hydrophobicity -27.71
Aliphatic Index 54.79
Half Life
Mammalian: 4.4 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 8605
Absorbance 280nm 183.09
Polar residues 25
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 19271288
Title Interactions between two carnobacteriocins Cbn BM1 and Cbn B2 from Carnobacterium maltaromaticum CP5 on target bacteria and Caco-2 cells
Doi Not available
Year 2009
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 6227
This work is licensed under a Creative Commons Attribution 4.0 International License.