This work is licensed under a Creative Commons Attribution 4.0 International License.
Eosinophil cationic protein (1-45) [C23,37S], RNase 3 (1-45) [C23,37S]
General Information
DRACP ID DRACP03529
Peptide Name Eosinophil cationic protein (1-45) [C23,37S], RNase 3 (1-45) [C23,37S]
Sequence RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR
Sequence Length 45
UniProt ID P12724
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C246H382N80O62S
Absent amino acids CDEGV
Common amino acids R
Mass 626927
Pl 12.9
Basic residues 9
Acidic residues 0
Hydrophobic residues 15
Net charge 9
Boman Index -13535
Hydrophobicity -91.11
Aliphatic Index 60.89
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 12490
Absorbance 280nm 283.86
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31540052
Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides
Doi Not available
Year 2019
Literature 2
Pubmed ID 23716047
Title Two human host defense ribonucleases against mycobacteria, the eosinophil cationic protein (RNase 3) and RNase 7
Doi Not available
Year 2013
Literature 3
Pubmed ID 21696142
Title Refining the eosinophil cationic protein antibacterial pharmacophore by rational structure minimization
Doi Not available
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 6543
This work is licensed under a Creative Commons Attribution 4.0 International License.