This work is licensed under a Creative Commons Attribution 4.0 International License.
Enterocin AS-48
General Information
DRACP ID DRACP03530
Peptide Name Enterocin AS-48
Sequence MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW
Sequence Length 70
UniProt ID Q47765
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C328H549N87O89S
Absent amino acids CDHQ
Common amino acids A
Mass 839853
Pl 10.83
Basic residues 10
Acidic residues 4
Hydrophobic residues 35
Net charge 6
Boman Index -61
Hydrophobicity 53.86
Aliphatic Index 117.14
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 12490
Absorbance 280nm 181.01
Polar residues 19
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29987141
Title Synergistic activity of AS-48 with ethambutol was observed on M tuberculosis-infected macrophages
Doi Not available
Year 2018
Literature 2
Pubmed ID 20833793
Title Insights into the functionality of the putative residues involved in enterocin AS-48 maturation
Doi Not available
Year 2010
Literature 3
Pubmed ID 19958277
Title Conformational stability and activity of circular Enterocin AS-48 derivatives
Doi Not available
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 6694
This work is licensed under a Creative Commons Attribution 4.0 International License.