This work is licensed under a Creative Commons Attribution 4.0 International License.
Ribonuclease 7 (1-45) [C23,37S]
General Information
DRACP ID DRACP03543
Peptide Name Ribonuclease 7 (1-45) [C23,37S]
Sequence KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH
Sequence Length 45
UniProt ID Q9H1E1
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C227H364N70O65S3
Absent amino acids CEVY
Common amino acids K
Mass 599498
Pl 11.53
Basic residues 11
Acidic residues 1
Hydrophobic residues 9
Net charge 10
Boman Index -11372
Hydrophobicity -120.89
Aliphatic Index 39.11
Half Life
Mammalian: 100 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 125
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31540052
Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides
Doi Not available
Year 2019
Literature 2
Pubmed ID 23962023
Title Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus
Doi Not available
Year 2013
Literature 3
Pubmed ID 23716047
Title Two human host defense ribonucleases against mycobacteria, the eosinophil cationic protein (RNase 3) and RNase 7
Doi Not available
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 7120
This work is licensed under a Creative Commons Attribution 4.0 International License.