This work is licensed under a Creative Commons Attribution 4.0 International License.
Non-secretory ribonuclease (1-45)[C23,37S]
General Information
DRACP ID DRACP03562
Peptide Name Non-secretory ribonuclease (1-45)[C23,37S]
Sequence KPPQFTWAQWFETQHINMTSQQSTNAMQVINNYQRRSKNQNTFLL
Sequence Length 45
UniProt ID P10153
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C241H365N71O71S2
Absent amino acids CDG
Common amino acids Q
Mass 624209
Pl 10.89
Basic residues 5
Acidic residues 1
Hydrophobic residues 12
Net charge 4
Boman Index -11412
Hydrophobicity -106.89
Aliphatic Index 45.56
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 12490
Absorbance 280nm 283.86
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31540052
Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides
Doi Not available
Year 2019
Literature 2
Pubmed ID 23962023
Title Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus
Doi Not available
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 7640
This work is licensed under a Creative Commons Attribution 4.0 International License.