Non-secretory ribonuclease (1-45)[C23,37S]

General Information


DRACP ID  DRACP03562

Peptide Name   Non-secretory ribonuclease (1-45)[C23,37S]

Sequence  KPPQFTWAQWFETQHINMTSQQSTNAMQVINNYQRRSKNQNTFLL

Sequence Length  45

UniProt ID  P10153 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Antifungal



Structure Information


PDB ID  Not available

Predicted Structure  DRACP03562

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C241H365N71O71S2

Absent amino acids  CDG

Common amino acids  Q

Mass  624209

Pl  10.89

Basic residues  5

Acidic residues  1

Hydrophobic residues  12

Net charge  4

Boman Index  -11412

Hydrophobicity  -106.89

Aliphatic Index  45.56

Half Life 
  Mammalian: 1.3 hour
  Yeast: 3 min
  E.coli: 2 min

Extinction Coefficient cystines  12490

Absorbance 280nm  283.86

Polar residues  15

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31540052

Title  Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides

Doi Not available

Year  2019

Literature 2

Pubmed ID 23962023

Title  Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus

Doi Not available

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  7640

DRACP is developed by Dr.Zheng's team.