This work is licensed under a Creative Commons Attribution 4.0 International License.
Angiogenin (1-47)[C26,39S], Ribonuclease A A1 (1-47)[C26,39S]
General Information
DRACP ID DRACP03564
Peptide Name Angiogenin (1-47)[C26,39S], Ribonuclease A A1 (1-47)[C26,39S]
Sequence QDNSRYTHFLTQHYDAKPQGRDDRYSESIMRRRGLTSPSKDINTFIH
Sequence Length 47
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C242H374N78O77S
Absent amino acids CVW
Common amino acids R
Mass 646082
Pl 9.73
Basic residues 11
Acidic residues 6
Hydrophobic residues 8
Net charge 5
Boman Index -18601
Hydrophobicity -142.98
Aliphatic Index 43.62
Half Life
Mammalian: 0.8 hour
Yeast: 10 min
E.coli: >10 hour
Extinction Coefficient cystines 4470
Absorbance 280nm 97.17
Polar residues 16
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31540052
Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides
Doi Not available
Year 2019
Literature 2
Pubmed ID 23962023
Title Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus
Doi Not available
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 7643
This work is licensed under a Creative Commons Attribution 4.0 International License.