Angiogenin (1-47)[C26,39S], Ribonuclease A A1 (1-47)[C26,39S]

General Information


DRACP ID  DRACP03564

Peptide Name   Angiogenin (1-47)[C26,39S], Ribonuclease A A1 (1-47)[C26,39S]

Sequence  QDNSRYTHFLTQHYDAKPQGRDDRYSESIMRRRGLTSPSKDINTFIH

Sequence Length  47

UniProt ID  W0UV28  P03950 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Antifungal



Structure Information


PDB ID  Not available

Predicted Structure  DRACP03564

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C242H374N78O77S

Absent amino acids  CVW

Common amino acids  R

Mass  646082

Pl  9.73

Basic residues  11

Acidic residues  6

Hydrophobic residues  8

Net charge  5

Boman Index  -18601

Hydrophobicity  -142.98

Aliphatic Index  43.62

Half Life 
  Mammalian: 0.8 hour
  Yeast: 10 min
  E.coli: >10 hour

Extinction Coefficient cystines  4470

Absorbance 280nm  97.17

Polar residues  16

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31540052

Title  Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides

Doi Not available

Year  2019

Literature 2

Pubmed ID 23962023

Title  Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus

Doi Not available

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  7643

DRACP is developed by Dr.Zheng's team.