This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin B (1-24)+(1-10)
General Information
DRACP ID DRACP03584
Peptide Name Cecropin B (1-24)+(1-10)
Sequence KWKVFKKIEKMGRNIRNGIVKAGPKWKVFKKIEK
Sequence Length 34
UniProt ID P01508
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C194H323N55O41S
Absent amino acids CDHLQSTY
Common amino acids K
Mass 470289
Pl 11.69
Basic residues 13
Acidic residues 2
Hydrophobic residues 12
Net charge 11
Boman Index -6839
Hydrophobicity -90
Aliphatic Index 74.41
Half Life
Mammalian: >20 hour
Yeast: >20 hour
E.coli: ?
Extinction Coefficient cystines 11000
Absorbance 280nm 333.33
Polar residues 5
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 11004545
Title Conformational study of a custom antibacterial peptide cecropin B1: implications of the lytic activity
Doi Not available
Year 2000
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 7842
This work is licensed under a Creative Commons Attribution 4.0 International License.