Peptide Libraray

Defensin-like peptide 4, DLP4, Hill-Def2a

General Information

DRACP ID DRACP03604

Peptide Name Defensin-like peptide 4, DLP4, Hill-Def2a

Sequence ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK

Sequence Length 40

UniProt ID W5U4X3

PubChem CID Not available

Origin Synthetic

Type Native peptide

Classification

Active ACP

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Nature Anticancer; Antibacterial; Antifungal

Structure Information

PDB ID Not available

Predicted Structure Not available

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C179H294N62O48S6

Absent amino acids EMQY

Common amino acids A

Mass 497092

Pl 9.24

Basic residues 10

Acidic residues 2

Hydrophobic residues 14

Net charge 8

Boman Index -6899

Hydrophobicity -13

Aliphatic Index 61.25

Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min

Extinction Coefficient cystines 5875

Absorbance 280nm 150.64

Polar residues 13

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 34985302

Title In Vitro Evaluation of Antimicrobial Peptides from the Black Soldier Fly (Hermetia Illucens) against a Selection of Human Pathogens

Doi Not available

Year 2022

Literature 2

Pubmed ID 28935900

Title Antibacterial and immunomodulatory activities of insect defensins-DLP2 and DLP4 against multidrug-resistant Staphylococcus aureus

Doi Not available

Year 2017

Literature 3

Pubmed ID 25956195

Title Purification and characterization of a novel antibacterial peptide from black soldier fly (Hermetia illucens) larvae

Doi Not available

Year 2015

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID 8170