This work is licensed under a Creative Commons Attribution 4.0 International License.
Laterosporulin 10
General Information
DRACP ID DRACP03647
Peptide Name Laterosporulin 10
Sequence ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL
Sequence Length 53
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C265H407N75O75S7
Absent amino acids S
Common amino acids CGKV
Mass 699577
Pl 8.11
Basic residues 9
Acidic residues 5
Hydrophobic residues 14
Net charge 4
Boman Index -7991
Hydrophobicity -42.83
Aliphatic Index 62.45
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 11835
Absorbance 280nm 227.6
Polar residues 18
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28422156
Title Anticancer properties of a defensin like class IId bacteriocin Laterosporulin10
Doi Not available
Year 2017
Literature 2
Pubmed ID 27267959
Title Laterosporulin10: a novel defensin like Class IId bacteriocin from Brevibacillus sp strain SKDU10 with inhibitory activity against microbial pathogens
Doi Not available
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 9529
This work is licensed under a Creative Commons Attribution 4.0 International License.