This work is licensed under a Creative Commons Attribution 4.0 International License.
Ribosome-inactivating protein PD-L1/PD-L2 (47-77), IKY31
General Information
DRACP ID DRACP03695
Peptide Name Ribosome-inactivating protein PD-L1/PD-L2 (47-77), IKY31
Sequence IKYLLVKLQGASQKTITLMLRRNNLYVMGYS
Sequence Length 31
UniProt ID P84853
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C164H276N44O43S2
Absent amino acids CDEFHPW
Common amino acids L
Mass 415168
Pl 10.79
Basic residues 5
Acidic residues 0
Hydrophobic residues 11
Net charge 5
Boman Index -2738
Hydrophobicity 10.97
Aliphatic Index 122.58
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 4470
Absorbance 280nm 149
Polar residues 11
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29684330
Title Novel bioactive peptides from PD-L1/2, a type 1 ribosome inactivating protein from Phytolacca dioica L Evaluation of their antimicrobial properties and anti-biofilm activities
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 11272
This work is licensed under a Creative Commons Attribution 4.0 International License.