E10-Ctn[15鈥?4]

General Information


DRACP ID  DRACP03706

Peptide Name   E10-Ctn[15鈥?4]

Sequence  EEEEEEEEEEKKRLKKIFKKPMVIGVTIPF

Sequence Length  30

UniProt ID  U5KJM4 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C165H269N39O52S

Absent amino acids  ACDHNQSWY

Common amino acids  E

Mass  418066

Pl  4.49

Basic residues  7

Acidic residues  10

Hydrophobic residues  8

Net charge  -3

Boman Index  -8188

Hydrophobicity  -113.33

Aliphatic Index  71.33

Half Life 
  Mammalian: 1.3 hour
  Yeast: 3 min
  E.coli: 2 min

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  2

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 30042491

Title  An acidic model pro-peptide affects the secondary structure, membrane interactions and antimicrobial activity of a crotalicidin fragment

Doi Not available

Year  2018

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  11541

DRACP is developed by Dr.Zheng's team.