This work is licensed under a Creative Commons Attribution 4.0 International License.
cLFchimera
General Information
DRACP ID DRACP03708
Peptide Name cLFchimera
Sequence DLIWKLLVKAQEKFGRGKPSKRVKKMRRQWQACKSSHHHHHH
Sequence Length 42
UniProt ID Q9TUM0
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C229H367N79O53S2
Absent amino acids NTY
Common amino acids K
Mass 587055
Pl 11.82
Basic residues 18
Acidic residues 2
Hydrophobic residues 11
Net charge 16
Boman Index -12986
Hydrophobicity -136.67
Aliphatic Index 55.71
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 11000
Absorbance 280nm 268.29
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29890331
Title Recombinant production of a chimeric antimicrobial peptide in E coli and assessment of its activity against some avian clinically isolated pathogens
Doi Not available
Year 2018
Literature 2
Pubmed ID 29619665
Title Expression and Purification of the Main Component Contained in Camel Milk and Its Antimicrobial Activities Against Bacterial Plant Pathogens
Doi Not available
Year 2018
Literature 3
Pubmed ID 30208331
Title Heterologous expression of a broad-spectrum chimeric antimicrobial peptide in Lactococcus lactis: Its safety and molecular modeling evaluation
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 11733
This work is licensed under a Creative Commons Attribution 4.0 International License.