This work is licensed under a Creative Commons Attribution 4.0 International License.
Ha Coleoptericin 1, Col1
General Information
DRACP ID DRACP03713
Peptide Name Ha Coleoptericin 1, Col1
Sequence SLQPGAPNFPIPGQEKQEGWKFDPSLTRGEDGNTLGSINIHHTGPNHEVGANWDKVIRGPGKAKPTYSIHGSWRW
Sequence Length 75
UniProt ID Not available
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C370H553N109O108
Absent amino acids CM
Common amino acids G
Mass 957622
Pl 9.17
Basic residues 12
Acidic residues 7
Hydrophobic residues 19
Net charge 5
Boman Index -14330
Hydrophobicity -98.53
Aliphatic Index 53.33
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 23490
Absorbance 280nm 317.43
Polar residues 26
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30269257
Title Biological Profiling of Coleoptericins and Coleoptericin-Like Antimicrobial Peptides from the Invasive Harlequin Ladybird Harmonia axyridis
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 11808
This work is licensed under a Creative Commons Attribution 4.0 International License.