This work is licensed under a Creative Commons Attribution 4.0 International License.
Ha Coleoptericin 6, Col6
General Information
DRACP ID DRACP03715
Peptide Name Ha Coleoptericin 6, Col6
Sequence SLQPGAPKLPYAWSRKQEGWKFDPSLTRGEDGNTLGSINIHHTGRNHEVGANWNKVIRGPGKAKPTYSIHGSWRW
Sequence Length 75
UniProt ID Not available
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C379H572N116O105
Absent amino acids CM
Common amino acids G
Mass 975351
Pl 10.86
Basic residues 15
Acidic residues 5
Hydrophobic residues 20
Net charge 10
Boman Index -16094
Hydrophobicity -103.2
Aliphatic Index 54.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 30480
Absorbance 280nm 411.89
Polar residues 27
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30269257
Title Biological Profiling of Coleoptericins and Coleoptericin-Like Antimicrobial Peptides from the Invasive Harlequin Ladybird Harmonia axyridis
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 11811
This work is licensed under a Creative Commons Attribution 4.0 International License.