This work is licensed under a Creative Commons Attribution 4.0 International License.
Ha Coleoptericin-Like peptide, ColLC
General Information
DRACP ID DRACP03719
Peptide Name Ha Coleoptericin-Like peptide, ColLC
Sequence DSEGWKVQPNINRDQDGNTAGSVRVQKQLGNHEVHAGASRVFSGPNRGGPSYNVGATFNW
Sequence Length 60
UniProt ID Not available
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C277H421N91O90
Absent amino acids CM
Common amino acids G
Mass 751849
Pl 9.26
Basic residues 8
Acidic residues 5
Hydrophobic residues 16
Net charge 3
Boman Index -15040
Hydrophobicity -98
Aliphatic Index 48.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 12490
Absorbance 280nm 211.69
Polar residues 24
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30269257
Title Biological Profiling of Coleoptericins and Coleoptericin-Like Antimicrobial Peptides from the Invasive Harlequin Ladybird Harmonia axyridis
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 11821
This work is licensed under a Creative Commons Attribution 4.0 International License.