Brachyin

General Information


DRACP ID  DRACP03773

Peptide Name   Brachyin

Sequence  CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS

Sequence Length  41

UniProt ID  Not available

PubChem CID  Not available

Origin  Animalia

Type  Native peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Insect



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C215H309N57O64S6

Absent amino acids  FHIMQ

Common amino acids  CY

Mass  562216

Pl  7.72

Basic residues  6

Acidic residues  5

Hydrophobic residues  6

Net charge  1

Boman Index  -9532

Hydrophobicity  -97.07

Aliphatic Index  28.54

Half Life 
  Mammalian: 2.8 hour
  Yeast: 3 min
  E.coli: 2 min

Extinction Coefficient cystines  20315

Absorbance 280nm  507.88

Polar residues  21

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 25329070

Title  A novel neurotoxin from venom of the spider, Brachypelma albopilosum

Doi Not available

Year  2014

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  12435

DRACP is developed by Dr.Zheng's team.