This work is licensed under a Creative Commons Attribution 4.0 International License.
Cathelicidin Ps-CATH6
General Information
DRACP ID DRACP03774
Peptide Name Cathelicidin Ps-CATH6
Sequence KKPSKKPKPQAMTFPKVTVEYFPASFSTAALTVPED
Sequence Length 36
UniProt ID A0A2Z4HVI6
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C184H289N43O52S
Absent amino acids CGHINRW
Common amino acids KP
Mass 459207
Pl 10.29
Basic residues 6
Acidic residues 3
Hydrophobic residues 11
Net charge 3
Boman Index -4623
Hydrophobicity -54.44
Aliphatic Index 46.11
Half Life
Mammalian: 1.2 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1490
Absorbance 280nm 42.57
Polar residues 8
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30452933
Title Roles of polymorphic cathelicidins in innate immunity of soft-shell turtle, Pelodiscus sinensis
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12436
This work is licensed under a Creative Commons Attribution 4.0 International License.